TTHERM_00394590

Length: 335 bp

protein Sequence

MDVQQKRKVYNQKYLRIKKINEGSFGKIILCELVDQKGQYCVLKKFKVTQQSAIDELSIKEIYYMKKLDHPNLVKSDDIFKIKKSYNGQDFFEQLYMHLPYYLEMSEVPRENLSVEAIKILIKQLIEAVHFLHQKKIIHRDIKPSNIFLDKTGKLLLGDMGISRDFPENKDQELTGNTITRLYRPPEILFGCKKYNETVDLWSLGCTIAEFFMDHKKYFFQGKSEIDQLCKVFEIRGSANEQNWPGCTELPYYMDFGELNQKDLSSLLPKAPKECIEIIDSLLQLCPQKRAKIEDIIQNKWLQSTTEQGFQELKQFAENNIQSNIHKILHPPERF*