TTHERM_00395730

Length: 284 bp

protein Sequence

MQQLEQVKSNLDMNCLEEQSFDFEQCYGQYIMLQTPSHSLLSSENQNSEDQQQEENRNQELLSKKIVKKRAKKVSKFIQQKLKQKLQINEKLDISLFKNIQLHKDIFYIFGDQIIELDYNLKPFEDRPIDLNQITQFKSVKMVEKIKQIDTIELNYDRFLQSDQRDLYQFGLCLQKLQNLSVCCQNDLNKHHQILTNPQNCFAMIEKQNLFYQKSYEWIKSKTDESDFFTYTLSKLNQENMIFQTNKTGISNSFIALLGGDFDTISQVALRKGGLHFLNSRSRQ*