TTHERM_00399450

Length: 107 bp

protein Sequence

MFNPFSRKDSKGEAHQNRQKAIEKLSVLQNKQDAFIAIKELEHNLYKHCFKKCLKLDDQLFQDEERDCLTNCNAKIAQFLQISKDNFSNVEQNIQVLKQMVKGKPSI*