TTHERM_00402060

Length: 258 bp

protein Sequence

YLINRLSIKWHIINKTQQKISILNITSNSQLALQGVLNMAATTQDYGLIENAILNNIQIIKNDFMLLHQRQKGMINQLENDFLQAIPEKIKNMSVADFLYKFDGDLNKAFCQLSVVDLNLSQTLSNASTLPLQNNTNFVSNNNKLIYSQVQSSSFMENFPKSNNYNPINSSNSKSILKNSKRKRNEYEQNQKKLLNNLYQTHQNNYSNNKENFSQNGTSQMHFQQQSKQNTAKKNNNTNNNNQNQNTTSKSGKKIWKF*