TTHERM_00402090

Length: 384 bp

protein Sequence

MKSILLYTLFALIYSQVKAQIIFFEQDSQCRQYVSFNFGSSDQIIKFQMELYSTISFVFSTSCPGNQCVSNQKLDCQSSNGCKVSSQTENIINAANQTIFYANQATSSIFCQGCKEMSIKQLNFDFVYSAAAYQYYDYAMLGLFPSNSFSNFYNQVQSDTYRSEQNLWFALASCYNKNRDLNTDSQMGFLSFNETITNRQTQRIFPLLKSDTTQKYFQARVIFYDQIFVGSYQLQNNYQFIEVYQQIFDNIVTRVSQKYRIQYATAQQDIMVLTCNPCLDLDDMVILNTVDQYQYKPIQINRKYLTTSYNSSHSIFNIIASKEQVLNMGVPFFYDNVVLIAGSVINVYDQKYPDANTIISSSSQIISYQIIYLGLLLLALMIFG*