TTHERM_00411540

Length: 293 bp

protein Sequence

MAAIRKKVFIFTLSGMTLMTMSACRWQYNRYHYSVNKWKVLDEQFKKEEPDQIQFSNLPWQEQLAKNNKLNIEDFEYRLIRLKGLLKGQRFFIHRHQDGRPGYLIVAPFIDSTQNTNNALVVNLGWIPSNMKQKFDNIKYNDEEIELSALIKRPEKIDYVNQQQIQSMKKMEQMNQSTSNQQQTSKQQNLQNQDSGKIIPEQSRFNSFIDLEFLKKEFNCNLDTNAYLEKFISRKQYNQLSISDSDDDLYPVCSSPQTFSKPYLTPDKHLSYCTFWGCCTTFGIITIIRALRV*