TTHERM_00419850

Length: 338 bp

protein Sequence

MKKRKHLENQTVQKITFKFAALAQWLEHSPSKRKVGGSIPPSGSSFLSFLSKKFIIKYLIFFLNRKKQDILVIFNKQIEFPCNLEEVIIKQEEKNFQRIATMTSNIVKAFQGLNNLTLKMNSSLFNKQQYFATKMQASSTQNGRDSIGRRLGIKKFGGEEVFPDDILARQRGFKWHAGQNTYVGKDHTIHSKVEGHVRFEKKYTDTNRKVVTVHVEPGQVRNQYNRPPPPFVYHPELYPERAVNNPAPTNFQVYKQTVQKVKRTDFRGSKVENANRNVVQIPQAYLEQQNHWEVKQDNGQNIIQAMQKLESKLLGIQYEPIIEDVQGEQEVEVSQQSK*