TTHERM_00419950

Length: 205 bp

protein Sequence

MSQIEENSTTVQKDPTEFTPTSFKVIGKREDIPVLKEIGQKIDESKRLKEEGNQFFKQKDYKKALSSYNKAILYVIGLVGENDEHYQYGNASSKLNEEQDLIVKELKSSLYLNISQIDLFNKNYAKCIERATKSLDIKQTAKGYYRRAIAYMELNDFQRSQQDFQKSLQLDQTLEKDIQQKIQILKQKEKQEDKKSQAFYSKMFN*