TTHERM_00420540

Length: 454 bp

protein Sequence

MMCLVCLYGCAVRGHKHLDHIDKVYDISELLDVEQLKKCFLQQDQTILREENINSIQPDQIESKIEKIIEGFSQAARSCKKALIEQLLQNENSNTQDQQKLIQSFYIQLKQYQNGEIDHVSLNEIAKLFTYSIQNEHKQNQMEIENENENQSSKQEDKENISFQIQQCIKELESISQQTSQIFLDLCKKLESNRISNYNDIIENHKQSIQQASTKLSQFNLVKVQNKQLNQQNTQLISKNVNNKQNRYNELIIKLIQNFLCTSDNPYFDQTLYEQLNQLETMDNLKQLVISISYFTQIITESFLANLSNSLEQLKKLKYLKINLKQIKNVILRIQRRIIQIFAFFKKSHEIEKSSLKNSVSIFQDKQKIFKKLQICENNRSSNQISEYFYMELNETLAQLSNLEELELNFQKYQFSALSDYIDLKNNIQKPCELTPMVQLTGEADSAKETFYNN*