TTHERM_00425840

Length: 401 bp

protein Sequence

MINNNILYLCLILIVSGTFAFKIAPDQQCVVKPEHQQKGFGCLPQYSHTELGHAYQKNFNSSVANNTDFQSLDQFALTYFTEDKCTYYQDLQVNVIYNDSYVKQVMYENFTSAFQNKTVNIVKYSPYPDGNQPDYLFYSQYFDCKSSKIILPKLFEEKGESYNVCLFNEVKYLNNSIDCNLAHLFHYSSEQLFGFFNTSSFQDFIYDHAVHVISNLKEVDADFSPFGSKQWYFTFNFMLQMTLDVKEYESLNQTLKFFNTAVPKAQLNRQIRPWFVGIASYSPYELDLNGGIILNEALYGSLYDNIKSNQFDILISSHPDLQQAKVFISKDYRNFSQVNDTNSLTALSQFEAFVLIYIPSQLETPAILNTSFDSLRINLEGKEIINISAAKQQTGIQKDIY*