TTHERM_00429650

Length: 520 bp

protein Sequence

MGNTLQYIPYFNKKDNSFQDKSLAEQISGLHTDTGSDQTKADYFLKDNLSLSIKLLNNKIVMDKKNNQIIPGVVSVEAKDFDADQVKKDKVRYQPLDLIFVIDTSGSMQGKKIELVKKSILQVLHIIQGDDRISLVGFNSQAKVLLELTQLTKNSKKKIQKTVDELQAGGGTQIGFGMQKAFDIIKERTNSKNLASIFLLSDGQDNCGFSQTQHFMNQSKIEYPFCIDCFGFGDDHDSLTLSKINQLQQGTFNFIRDISQIDDAFTIILAGIKTFVAQNVKISVNFGNTELMNGITVSKTYGSEWKKIQDKQYEIQLNHLMAGRSKDFVFELQIPQFEMKLTDQQRYQIIGSAKIKANSLNQGKKKITKKANLMVELFLNTEVQKKDLEKEDDEKVAINHFRVIAGEAMGTVLAQADKNQFENSQSLLNEIINKIKNSKYKNNPTILNLLKDLHNCQQAAQSSNYSTFGRGYVMNAQQVTIGQQVACNFDYKYANRDYILAEQNMGQERFRSINRRYQNQ*