TTHERM_00433450

Length: 209 bp

protein Sequence

MIRDFVLQQTTEPEKKFNSTVLIGNWYEERCDPNREQSKFYNERKFADNNYQKYTLSEVNSILKKNKFQDTSNSWLNFQENKPEVKNDQFITMNMRLTEIKLLSNIIIYLIQLMIYSFINKQINILITSPTHSYQQSIYQRFYLVFTFEIKRQEYKKPSEQKRNSELKPFIVKKSHFDKNPHELEEYREKWTKSAHTFDRMYLGTQKPN*