TTHERM_00433610

Length: 377 bp

protein Sequence

MVQLSDILSCPDNTDALANQIISGQEYDVLQKAIQNLSIDDQKLVFTQKFLKSLISMYSKIDIKNMQTIGEFIVKTLKDKMFFEYEVYQTRVELSKVYEGMNQPYLAGQILAQVNYDSPKLQLSVKEKVDKYLSIITFFFEMEEQTAAETWISKAGNINYDLIDDKYYKFRYENLFAVNLDFQRKFLPAAQKYYYLSNYPDIDFEEANLLLNAASQCAILGNAGPLRTRILATLYKDERIQSIPNFEMLELTYMQRIVSKEQKDKFAGSLKKHQLQILRENFTVLDEAILQHNITAVSQVYESITMKSLSRLVYIGRDIVEVCIQTMIEEKRINAKIDQLIDTVSFQRDEDIPVDFNDRISQFCGRLNEFYEKITAK*