TTHERM_00438880

Length: 307 bp

protein Sequence

MGKCAAFLSVLIDSSHSLCNNNIYLNGQTQQCGVVQLPGSQNSVANLQFNNFEATVVFSTKYLSTSSDSENLCFGNAQQEQLSFVKQLQQQRLISQQRVYITLFDRYLQQDPPSSIIGYINLEEPNPDYIKQGSSFVKILTSDSPFLFQLNGQITFFDQLISVASNKIQLKFPNQVDNQFDQATCDQVFKILQQNNFNVIKDSGKYYLLYIQGLGPIKIALQTENNNPYILSIDPSQYIEEIIKGYYRLRIQCGNSFWLSQSVLTSYYVGWDLETQSTYIAERVEGLNPQYAAQDAQSSSNLRSLNI*