TTHERM_00442910

Length: 526 bp

protein Sequence

MSDIGQTHQLQTNTDLTDQTIQDKAEEASQNQILKPEETQAISSDNQNKINNNITIKLSKVELNSKIALEIFNEQISPILDFIEHTNKDLDQHKLEINMKHFDFKHSSLQSFGKLSQYADSNINNQQLKDAYHKSDENFPYHIQIRGDGNCFYRSFMINIMFMVIIQQNIEDALKIFQKVFKLKQVQYKLEKFNENQIDLTPEFKLHFLHFWMSKFIDCHRVLRLQQKYDLKKLFEEYNQHPFVDVSTVVIYPSYQYFITEESKANSPKYLLQYGQEAEDVIISIAAKAFQVDLKVKNIYRNHEGIFTDQFEYKFDENKVSNVVSVLFTKGHYNCLFEKQLLEQSIEKFNWPIEEVVQVEQQIQQYQQQDDNLELEQFQQYQNEVQEDKDKKLLKTDQQLDKIFGINRNPKINPVGQQKKEDMSDSDSDEGRVVEEPLPPHIIRFNDMAQHLLKKVIRQNPQGLEKDIALNLVKFVKSQPEFKIGDGEWQCIIGKNFGCSLTFDANVLAFFDLLPSRKSILLFKSG*