TTHERM_00446520

Length: 149 bp

protein Sequence

MKFKNNKKQIKQICNKQINQQFSNYLVNINVNFLLQIQQDFTNQLDIQGGLPWTKKNENIEKHPRLYGQEEAKMKTYSNLYGSQFPMLLTIERNILAQPSRLPGEKQSLLGLDIMMNRLNQIEFEDFLGTDNPEMHKLNAHERFLKSFD*