TTHERM_00448720

Length: 329 bp

protein Sequence

DFLKEVQIDQKSQRILNQKMSNQERQFCLEYLITGAHQQQKNLDCVFCFPEKLQQEFEKIQQKLKEEQEEEKDLPDENEFDDAYEDLRKQAEEEEEEETQNLVEKKLEQQIGEKLHHIQQQSVEALDQLLQNEKNIEFILDTSMGLVINPNNVNESRFTLARRVLSLTLEKWYPQLNKNGNQQQRLENEQRYQQELKKEFNIYSSEQDVQLSKQLVQISQVQLADEFLENIQLHGRKDRVLSTLQSRIQNCPPQITSIIVFTDYTSKDYSAWKQQIEEAIKQRQNAPKIHIISFNLAGPEKQEDKQASFDFFESISKLTNGTFKQFSSL*