TTHERM_00455090

Length: 217 bp

protein Sequence

KKQKGKNQSNNNNNIREEGKQIKEMILPHNNRQLARQYFDSLPENDINRKYYEGLKYETPKTFFGRFLNQFNIDAKLDTLSKFYTYQKTIRATQAELQEDRKSYLTNSLLFTAVSWFSIYQFARKGAVLPVLREYGRYFGTHRLFRQYLHTLVLPLLYTEYALNQKYYTHMEHLWTVHVNRLNQKILEDPLYTFYPQELNVPKHNIIVPTIFRDTPQ*