TTHERM_00462850

Length: 247 bp

protein Sequence

MADKFQPFQEETDHGDQNLDFNISMDDNSQQAKKSIDSDAKIQQQQQLQKQKQTITIPAESLPDYSKTVRVGETSYLSQASHPKMCILQLLFKASSITTLLLTSFVFDFFDTNKTFPFVIIVLSAAFDFWVVKNLTGRFLVKLRWWSEINEDGTEQWRFESYEDGVPPNAIDSGFFWFSQTGALVFWILCCIINLLAISPFYFTLSMINTILVGGNFTGYYKCKGAHQKKMKNAVSKLGLKIISDAF*