TTHERM_00463890

Length: 152 bp

protein Sequence

MNKFIIVLAAILAISSAQTFLCEEKDRSANKLCTDIYEPVCAIKQSNLQGGKPLRTTFSSHCNACKDSSVLFVAEGPCEAYPENGTFCHPNSVNNKMCPMIYSPVCGIVHNLFMLCQGGPCVQTFGNGCQACTGGSFFYTPGKCLSKFDQDQ*