TTHERM_00470710

Length: 133 bp

protein Sequence

MFGLTKNLLKFAQQANKMNSILNKTNTLQWASVYNYAPQKVVLRNEKSGYYANPDDVARRLIRLISLHDKVQNPSAITLKSTWSEIGVDPLSYVEIMLEAENEFYIELADEDLERFRTVEDAVEFIARNFFTN*