TTHERM_00481330

Length: 207 bp

protein Sequence

MALRRVLKNQFNLIHKGQAQAVRGGHGWDRPDVPLSFNPLYVHKRELSIFDTNMWMYDQVYPEYVISYNEIHLVDQWKGLKESFSQSAYWWAMMAMVFGFYFINTTPRQLGIDTNDLKGFLGEYYGQYKKRSGIRSNFLGLDVTGENSIIQPNYDRKNGIRDVIDSLNADAGKRKLINLEAKNFIERVEKECEQRILKKGGATQSHH*