TTHERM_00481340

Length: 370 bp

protein Sequence

MKQREFTSSVLENQNRLFQSQSEEKKVEENNLKLLNDCVKKGLNNNQQIQKQINQQTKMSTKEFSLSYEYQEGKWQETKESSCFSSQSCNKNLKIGAFNVLWGNSNKFINMFNRNEQRFNYIINKLIPQTDPDILSLLEVSEQFMEMLTSNQHIRNNYYLSHVKRKRIDYVHEVVMISKLPFSSIFMNDDDYGRCIFSIFTDSVPSNSFMVLTSHFWAYEQDYVSRSKQMELIDLSIQTNSFLENVNLPVKIQKAALEASQKSNIILQGDLNLHLKHEDSFIYKFGFVDVWREIYPHDDGYTWDAQKNKFVKSIYILDNRRMRLDRILLRNLQGSIYAAVIITCYCLKFKQTKSLKLIQSTNINKFINRY*