TTHERM_00486640

Length: 300 bp

protein Sequence

MDKLKQNQESQDLSQLIDLLDSIQKLSLQSANLLDPFQQSVIDSLKKIKEAELAIKKKNDVFDLPSLVYNQKIDARIVNNLFIEFQNQDKNDVFRLIFTSFALNLPFDSIQDDSPFNSQNMNEKLEYVEQILFQKEPIKIQIEDKFITSEQAKQVVMQIIRELAQESKTKNFLSLCYSLIKKIQNKINDLCVVALMRSIIFNAKEDSTPPYLELLDIFSELNSKPCIQDQKEFWWKVCNAFSCYIYLGQENQSPKKLGYPAIPDGQLQLPDMLLIKQNNQLKYIINENFKPVYIKKNKNK*