TTHERM_00487110

Length: 244 bp

protein Sequence

MNDLSVTTFTQDGYIKQVEYAQKAVSDSETILGVRCKDGVILGAEKKLQTKLMVEDSDRRIYNIQKNIGMIVGGRIPDGRNVVHRARKEAQEYEKYFSMPISGRILSERTGQYLHAHTLYGAYRPFGCSVIISSYDPIDGLQLHQSDNAGYCLGYYACAQGQGKQEVMAHFGRRNFRDLTCEEALPYVILALNKARKEANEGIYQYEVSWITEKNNYVHCHVPNDIRDSAQVQAEAMIEAEDSA*