TTHERM_00497120

Length: 447 bp

protein Sequence

MIGLFGKNILKFGRVQALNTGKYSALSLMNTSLNKNIPRNYIRMTKQDAVQIPSVEEATKYQQDFKLDETVTNPVHDLVKPGKEKLIGSWLLLTAAGVFGMIVLGGYTRLTQSGLSMTKWKPIDHKLPSTQEEWEKEFDNYKKYPEYQLVNKNMDLNGFKKIFFVEWAHRLWGSSLGILFGVPLLGFAALGWLKKPMFFRLTAMLGLGGLQGLIGWWMVKSGFEQKPDYQTKPRVSVYRLFTHLNMAIVLYGALLWNGLTLIRKPQQQALQLSHLAGTKTMRGLGIGLLHFVALNIMSGAIVAGIDAGKGFNTWPDMNGQMIPDGLMKRDPWYLNFFENRVLVQFNHRNCAYLTASWTGYMLYKSLSLNLAKHQRFQIGLLSFFILYQIASGITVLLHGAPPKESSGHQATALMTVTVALLTCHSFRKPSKQYLNYVQKFIQSQKTI*