TTHERM_00502440

Length: 416 bp

protein Sequence

MMLKEKVQKNLSQLNELFSELSKISLNMKTYVVILEDLYNLLEESTYKGDPQDLERRNDFEEIQDNNIYVEDYLSSSLKYQIEKDIDTCFAACEQIYKKQKSSLLKKTWQYLKILIFDDPEEVLQNENFSLLQKVLRVRLELKEKNFAILYKEITELRANQEYQYKYKRISEEQTEHKQSKPQQKMNTVYNLKNKNNLSGGEILDEKSNDNQLSFETPLPPDANNKFKNLGQYLKPNNSTSQNFFAQLKKDDQSSNSKSKPEKTQITSIKYKLEPQTHESLYCQDNFLQEVSICKIINLSEDMDVHEQYSYKDFYQFKRAQYIELLKSRQQDLGRISRNHASLRVKINNDNNQVGFYLVNHSPNGTYIQKSGTTEWIKLKEVGQESQIFEGDQIGLLFDSQDPTMYLIGYKFQLIE*