TTHERM_00522490

Length: 122 bp

protein Sequence

MDSNKRYKDLLSEDQRKSECENIRKNYPDKIPLIIEKHPKSKLEQIDRTKFLILEKLRVYQVNTIIRRKMSLNKVDALYLFVNDNILLRGDQCLKDVYEKYKDSDGFIYLSYCEYSSFGKNI*