TTHERM_00522820

Length: 455 bp

protein Sequence

MDKDSTFSSEKSLIDNVQVKIDEFKKQQGHLDRYHEKYRLAKKLIKEWGNLLKKTKQGAQKIVETQLKNMDICYEDEESINGINQILNLVKDMINIFSAKIGLYENELLKQHLILKEQGSKLYQINKQVKDSYKTEKEFYDQITKKFQDQQCKIVKNSFIKFRMTETFQEQNSKNDKSVSNGSTSLLQTNQSYMNTTANSFNLVLEMFKCEIEKQMIMSCNKCIQSILSITNVMKPFEFESLKSQIPNFIIERNKMQLEVIDEFLKRSRASKEINSKMISQNQLTHSFCYQNFKEFSQQFQSTSFQKKQKESRFYNHDQAIANKSPFSLYETNFNPFSQNADIEQSNVEKISVLQNMQINKLKEKNELQISEKQSLAQSEIKYNQTPQKQNLNTSKESKQKFNQASNQQSNSPYCKEFQFTVHQSDRQNDSSKDQKTNLKRQQENKQNSELHKQE*