TTHERM_00525130

Length: 242 bp

protein Sequence

MQSTITSTTSLTPQQILNQIIKPEYIKYYSDWIHTANEKEARGLQLLGAIYKHKGSKKFRAKPPSVQLQQLHAQQEFDFQKAEEMYRKSQITSSYGQEFGYLQKDLKPTQNVFKYKKCSDLPFAKPLSDLAKLFIDNWIELNDELEFQELVLACLRSLHSRCIAQEVPKTEMKTKYEWKEDWNLSKPIRIDKAGSDLKAYKTNYNAIFKQRLKQEHINEQLKQLDNSDFAKQLKIFKPFKIN*