TTHERM_00529600

Length: 486 bp

protein Sequence

MIAEEIRQPQNGDQHQEDIQNDEIFPESQSTQAWQSSKCALSTSNGSTYQIPQKKDKQEEQYNKNKMISYQMIPKQQLKPFNLFYLRGELFIDLNFNEFSRISNLNYFKQVRSATYVKEYGFLYVDYLIDSKQFDDHQRVAKLLKNYNDEDIYDLGEKIEKHEIVQQKHSEVKSQIMKYTSINNITSQLIAAKRQEFMLLRKEVLSHLPKDKYYMFVDYSFDYFDMTFKMIGNGMNQSFLKLLGCDFKSMQDILMRKGILDFVESKSKWKLLKRIVDNLKLRVETKLHYEDRIEMITLDDILIDANFSSDLYNCQANRIFENFFHPDYKDYLIDKGFLVFELHITDFHILKINSIRQKYIEEYGKTGNYENIQPQFDNLYRPHLLSNNKNDTEFDEKSYEMEIEQNQSFTDSEIQKKNQCQNVELTQNSQSNFIQELVTDIPYTIQSQYFLDKFYNQNKPLPKKQSDLQDKFPTKTCKYRVINQQS*