TTHERM_00545860

Length: 435 bp

protein Sequence

MISQIFILSARGDIIINRDFRSDLVKNTHEVFYRQVKLSKGDCQPLFNIDGVNFSYLKRAGLYIVATSRFDNSPSFILEILNRVCTVIKDFCGVLSEEAIRKNFILIYELLDEMIDFGYPQLIQTEQVKPHIANEPIVIKKQTLPTTTTGRLGSLFNQGTVSSIATNRPVNSQSKKNEIFVDVFEKISVLFNASGYVINSSIEGCIQMKSYLNGNPPLKLALNEDLVIGKGENGRVVLDDCNFHDCVNTNEFDLSKTLRIQPPDGEFVVMNYRVTSEFQTPFRIYPVIEEISNFKLELHLKVKACFPKEIFASYVTLTFPMPKLASNITNELGKNASNQSVDIENKGDVKMVKWNIKKFMGDTEQVLITKITLQSSANSYSARKEIGPINVSFEVPMYNVSNLQIRFLRIDDKEKSNPFRWVRFITQSSSYVCRT*