TTHERM_00547920

Length: 669 bp

protein Sequence

KDIDKIPILNTNQRKMNMIFIPGTLLQSKNNTYRIIKTLGKGQYGTVYLAIDSNQQQQFAVKQIFSQSLINKKLNELLNQELTIQKIIKSQHTVQVIEDFFDQNFKTHIIIQEYCDGGDLEQYVKKYKYLPEAQAISYLKQLLQAFKELHFHKCMHRDIKPSNILISQGLIKLGDFGFAKQLNDQDITKTALGTTITMAPEVFYQQEYSYEADMFSLGIVFYYMLFGQYPFKPQGLNPETLFLQIKEQNINFNLNGVTISRNTQDLIKQMTAYDRKQRITWLGIYQHPALQEQSRFPQEVMRYGMVQTDNVFNRGINEEFYQQNGQALYQQVFKNQNDALAYQFIQIKFEIQDNLPNQPNKPFNQQNINFVEEQNKKKLQQQAEQQEKEKKMILQQNEQELEKQKMILQQNEQELEKQKMIQQQKEQEELKQKILQQQMQEEQNKLQQLIQQKNQDFELGLQKYFHKRNTNCILIQMLNSIRNLKDFKINYQIPAFLTCKKLIKLIKEYGQTLLNKNNIFGMVYFKEFVQSKQYQDLIQMSNNDLEKVRLEYPQILQECKDNINKLRMNNAQLLSHLTSEECNDKFELQYKECLINYSLSLRELKTSEETEKQRNLFHHIILISDIAKIDTFQKNNFNFDFERYKKEVYNTPFNEMESKLDEACLKIFS*