TTHERM_00548300

Length: 529 bp

protein Sequence

MNFKKQQKDQLIFSSEDSLNSNNSFASSVEDNDQEDFNNNFMNLKDQMDHFFSQNPQLQDAIKFEPFKEPNSDEEDQNLNQGIDQQQNHHKPTGFDPYGNLKKSPKKDKQSSLIEHRNLEEVDRKKKIALDSDNNSESESPKKNREVKFNLENQKKEKSKLWTSMTKDIIRMGQFGCKTPTLETVNHRLNIFKSKIEKIDYLEYLQKEMTQTAGGLLSQQQAGQTANGQNLQYSTNQNAAASSQTNNNGKFVFKKFNLKLIKQYQGDQADEDGNLANKQSEQEEDDENIGRDSEGNIIYFSFKKRMQMELRQKVEKSRKIQEEEQRLKSSEIKQRSGDRRVNLTGRGVSDALKLIKQQQLIEKKKRANSEDEFRNKRKSFTGLKSEKSMENEEKKLQFADKDQNLNFQTRIGIALYQTYQQCAGDKESFKKTANFILKDYNKTKASFFKKKPFPPQTTKFTNEETKSLNVYLPDFSSNLYAPNKNNLFANIDAFELPPGTPEGDFIQIVDKILDGAVLRFWKESQNQQD*