TTHERM_00550910

Length: 431 bp

protein Sequence

MSVISIATGKCGISIQEKAWITLLKEQGINEEGFIECQNTHQGINVYFEEVKQDVYKPRSIIADLDDQEINRVQNGFLKRLFQSNTSFSKQESSQNIFPRGYYSHGAELKEEIEYEIQKQVEVCDKVDSIQVQRSLCGGAGSGLGNVISDIIMDNYFSQIIHNTLVQLPDIKDENSWNTLEIYNTILSLHSLVISDIVIPFCNSNISNMNQNSFQLQKQFNFDTINNVVSQIQPNFTCGIRYPGSINASSRKICTNLVPFARVKMMTATFLPFNYFRQNQISQLELTDMIPQTLNEKNFFFGYGNPSIITSRHIFRSSNIFEEELELQLVKLYQKQEIPAWLPNSYSFQYCKVSSALNKNQILTLILNRNIYIQLQIYKKKFDEMLKKRAFIHHYLQEGMDEMEFQEAKYNTADLITEYQILSSFDGGQEE*