TTHERM_00554630

Length: 647 bp

protein Sequence

MLYRKYMLNPAQVSGYEGMFGIIFALIGCLIGTYFQNDYIQEDFYQFVSQVFSFKNPAIFFLVLVVVLINIFSSCVNQIIIKQMSALTRAISDSNSFILGWLLFMMAGYYSFGWQYLLGYVISILGIIIFCEILVLPWFGFNKNRGHDFVAPKLNYYYSQEAYPYYYQANIPIQQQQNYNGYNNQVINLENNQQNQFLNQPLLAEINLAPNQQLQRPSNISNQDYYSQNRQQTLHQNLIDQPNNFSQNQLNFQTTKEVLKEILSMQFENLTQIKQIIVLIQDIQAKTPQQDHSTKNEIAKILKKIASQLTNDYLNTIKMRMLKLVQEDQYANVYKINEMRYISERLSFLVDNNNSNITIKSINEIIAWIEDNHQPTEFTQTLQNIQAINQLFLSEYQRNQESGLNWKDQYEAIQQKLKFNNSQGQQFEQSNISNSNTLNQSGQQKLDQNLMNQPYQLNQNEQYLNTTKEVLKEILSTEFENLTQVKQIIVLIDYINSKINQNDHSHKSEIGKISHKIASVLIKNYSNIIKIKIVKLILEDQFMNISKINEMRYIQDRLYFLVINSNINTKCLNEIIIWIENNLQPNGLTQVTENLQQINEQFLNEQKRDFQQSVSNWNEQYQAIFIEQKRQIKKQQPNEDQKKLIEI*