TTHERM_00568030

Length: 250 bp

protein Sequence

MNEIYEQNEKEEEEKSIILTMSSAVEKKDLPADYGKMPAGYNFLTRGKDWREYDKDFILRTDAVWEKFQLEHFFRNYMKCFFFDHGLKKYQMFEPEDMYTVVFEGWALDDLITFPGFTPTGRTNSYQIGLSPRQRTVVPTQTFYQMQDYYMLCGLRFERWFRCDLVYHDQRHTKFDQVKNQKNYKTYPCYREYYEAQYACQDDMFDFLMELAYARRAADNFESDFASHELTTLPTFYDTPKAAERKTYTY*