TTHERM_00577050

Length: 331 bp

protein Sequence

MDEDLEIIYLDQESGQLDSLKYYFSSQSMYSQKQQNTTYFILPLEQTSDYNCQKSCQANEIENQLQKNKGGNCIGGFIHCNYKGQAEKFKSEILELIKNSIYFKIGEFEEGFSNVLSTFKTRLFSLDIIYDTSYSVSLNKESSRIQISLNLFMKIEQKIYLSKSIIPSLLNNIWGIKNKGSNKYREVDYKVDFSKETPNYYLLKENSVFDIQELILILKERMNFSYIAGCLSTVLGIGIGAAGGHKKEWTQERKDLLTKATFYHFISNTGMIIGSYNNPFNYSTILFLIGVTCFSGSLYYKTFTNNEDFKRLPPYGGMAMMLGWILLAFKK*