TTHERM_00600100

Length: 324 bp

protein Sequence

MLSKTIRFCFARTQANFSKFSKTIIPDYFKTEPIIEGQYQVTPTLSVPQNIKRPDYVDNPNPIFGIYHGNPVVHNQDIIRRLKIAGNLAARTLAHLASHVKEGITTDELDKICHKFIIDNNAYPTALGFMHFPKSVCTSVNEVVCHGIPNTRPLKNGDYINLDVTLYIEGVHGDNSLMVPVGDVHPEIMKLIQTTQKALYESIKVCKPGTPFRKIGEVCESIAHENGFSVCELFTGHGVGELLHMAPAVFHEKKTRSENPYVMQPGMVFTIEPIFTMRRGRYQMWSDQMTVVSPYNPSAQWEHTILITEQGHEVITLRDGEKIE*