TTHERM_00600300

Length: 271 bp

protein Sequence

MSNNQEIFEKQVQSQDLQEQECKKKPKKFFDIDSLLSKLIKRLIPQQLNQKTQFCKHDCGCSEEIIKQTLKSFLLGYSVIGAVDIIALVLKSKMLKKNPFILFVTLVSSKNIRFASFPALYTLVMKSLMCVLRRIFKEDNGKIWFISGFVGGFLSLLTKEKNNRSMWSLFLLTRAFETFYRYHIIQKTIPKFQLDYVLVYCLMIGFTVSVYFTEPSCNSRGLHKAWENFSCEHSGDYGIRKIYMGIMNKKLQIDGLPTDEPDKFINWNRKF*