TTHERM_00614720

Length: 205 bp

protein Sequence

MGNVCGGSSQSSSSSKSQRALRLRDEKKPAQQAKVVLLGNIAVGKTAITQRFKQGIFDPAHQATLGAAYIEKNITLQDNSVLSLHIWDTAGDERYRSILSMFYRDSQAAILVYDVTDADSFNSLQLWINELEDKAKTEGMIIALVGNKIDSPYEMVKVSTQKAEQFAREKNFLFTECSAKTGEGIDRIFNMIVEELIKKKKSEHN*