TTHERM_00616320

Length: 127 bp

protein Sequence

MLARTLKNYMRVQQNLRFSRANIEKSPAPPTIGQVELEPFKFNHERDQLIYGYTMEELYGKKFGLKHSATVLREIKKDTIMMILFIIGGFTYCYHMRETRFQLDDDFNEYVNTNKQTFRPIPDHVKL*