TTHERM_00616330

Length: 295 bp

protein Sequence

MQVKAIQNQTLYNLIQLSKNEKNDHLRQAVRFDFETSKPAEILELIHDMDQKAIQNEQKYKLQKIRRICFIDYDPLEEKDKKLEKYLQLFSNEKTLAEYKFYCLKEGLNSFSKKYPFLMLNNDDFENIEEKKKEAPKDSRDILNDKQKKVLYSYSQFPFEIVEDVLFLGNVYHSNSQMYLNDLSIKIMIDFITYSEEDTQKIPSFKTEKFEYKNIPLDAKQSVTLDFDEINKYIEQQISENKGRVLLYCSNGQSISPAFAISYLMYKQKMNIQLASKVNIAQWIYTQLLVYKPKY*