TTHERM_00621060

Length: 209 bp

protein Sequence

MRQPNNLNELFPIPREHSLNQKTPIVLNVCDQDANYQKQLDQSGEIAKINQQLEKIILENKNTKENRKNLIAKIVAQTVMEGASNQKIVYKTRGILTKVGRAIAVDLSDSNLPHDQGIKPHMTVVFSKERFTQEDINELYSLEQQFRISQGLQQDENYSFVLENWGPRSKKIQGQLYDLCIYLRQHFTGDSTDERIPHVELKKLERNRK*