TTHERM_00624620

Length: 212 bp

protein Sequence

MNTQIESFIERQRKNTIPQMFQNNQRYQYNQADINKSNPLGFLKLWNQPKVKEQLKQSIQQKMQQGTIPSDKIINEKMLITEYWSQWLDLNQTDFLQLIQKNPRLTVQDHQDIQSLILDENARMGNWVLGMSIFTYGVYFLGLKKHAMFYNRFQKKSPYKIVNYSKNALGCLLVMSTWSIILKFFFEQAIPNQLSKKGFLSKYHILKEEVYL*