TTHERM_00627140

Length: 165 bp

protein Sequence

MLVNYDDSSDSEIENEKVEKDQKPEKIIPEQAQDQQKKKVKLLNFNQVMKKADEKSSITASSSYTSNLLNEAKKIDSQLNNANKISNEINSKRKLPKDYEEKVDCPVEQKYHKLNITEEELQKRKIEEQIANQAKTQSEAKEKQKKHMFVPPQIRNNTKNVSTEF*