TTHERM_00628450

Length: 210 bp

protein Sequence

MEKQFDVLIKRLNNLETILGENLNIQNEQNGGEIINPLVDKLNKAEIKLKDIISNVINGATFVQGQNTEISKSIQSINEFLRNSEMKYATAIIGSKNRADLLLRQEQEILQVIELLEQIEKNRKMISFDPILQVEEKKKMVEAFEFMSEISSQGGPLKVNKTSDQTIAETYIQQNEDIEQLIKDQADIIDTINKKFLYFDAVLTQLENKK*