TTHERM_00641240

Length: 311 bp

protein Sequence

MIGTFFNRFSKNLHSISKYNFTSNPEAKYKIVLLRHGESVWNKENRFTGWKDVQLSPKGIEEARSAGKTLKQNGYEFDVVYTSVLTRAIMTYNNLADELGCHHLPVIKHWRLNERHYGALQGLNKTETAEKHGEEQVKIWRRSYSTPPPALELDDERFPGHDKRYKHLPIQALPRTEALSDCVARVIPFWYDQIVPSVLAGKNVLVVAHGNSLRSIVKHVDNVSEQDIIGINIPTSVPLIYEFDANFKPIRNYYLADPEELKKKQEAVQNQDNQLSQIEIQRVDDALLRKLRDAKIYGLRMELTIQFMIEL*