TTHERM_00644610

Length: 185 bp

protein Sequence

MQQIAESQKTKKEYRDAVLFEEILNTQKIIPLYDCYGKVFRHELIKNLIFVLGGFGILYYFYNDPDSKPKKKTFLCALTLSFIATRVLTYRRLQKSFVDKIIYDTTTQMVTLTKRTFYGKRFDQELNPALLLFTNDKSLNMRNINYINMETLETYQIGYDYAWKNKALFSHILEQRIETIRNKKN*