TTHERM_00649420

Length: 392 bp

protein Sequence

MFSKGLLTKVLGKNLFKQCGLHNTLKYGFAFPTQPSDYANLKKLSQLMNAKVSFLTLTNDKIFSLISQFITIKQQLDINEEIDYDGQVRLINSNNKQLGVMPFEEAFNKAKDMNLDIVLVNSQSNPVICKTVNYKEEIYSKFAKEIISQEAESRKVDSKKPKKQIQISINISNADIRTKAQICRDISKKNPQIKVFIQTNDAQEDEHDLMVRSLLKDELDSEDLFNDKKATKQVELHLQTIEFNQTQSTYSTELIKKLVDQYLRELNNPKKDDAVIEELKTSSKTLKQLERFESNSKLLVSEQSLEEQINEFAKDIKDEEEDENMDKYLSALEEISKRQKRSIHDIQDEIDNLRFRLQTSKEQALVLSLLEREEKRLRDYKRTLKLAKAVRN*